Description
Acylated Amylin Analogue (Cagrilintide)
Acylated Amylin Analogue (Cagrilintide) is a synthetically manufactured, highly purified peptide designed to function as a long-acting, non-selective agonist at both amylin receptors (AMYR) and calcitonin G-protein coupled receptors (CTR). Mirroring the biological mechanism of endogenous human amylin—a neuroendocrine pancreatic hormone secreted alongside insulin to signal postprandial satiety—this engineered compound features an optimized 38-amino-acid backbone acylated with an eicosanedioic acid fatty chain via a gamma-glutamic acid spacer. This precise lipidation structure delays renal clearance and significantly extends metabolic stability, providing an advanced laboratory medium for investigating central neurochemical satiety circuits, gastric motility physics, homeostatic energy expenditure, and synergistic co-agonist behavior when paired with GLP-1 or glucagon pathway receptors in in vitro and in vivo research models. [1, 2, 3, 4, 5, 6]
Our Acylated Amylin Analogue reagent is synthesized utilizing advanced solid-phase peptide synthesis (SPPS) methodologies and high-performance liquid chromatography (HPLC) purification protocols. This process yields a pristine, highly stable lyophilized white crystalline powder cake optimized for chemical consistency, structural longevity, and reproducible results across high-throughput analytical screening.
Product Specifications
-
- Compound Name: Acylated Amylin Analogue (Cagrilintide)
- Sequence Matrix: {Eicosanedioic acid-γ-Glu}-KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH2 (Disulfide bridge: Cys3-Cys8)
- Molecular Formula: \(C_{194}H_{312}N_{54}O_{59}S_{2}\)
- Molecular Weight: 4409.01 g/mol
- CAS Registry Number: 1415456-99-3
- Physical Form: Lyophilized Crystalline Powder
- Purity Matrix: >99.0% (Verified via HPLC & Mass Spectrometry)
- Source: Synthesized in the USA
- Packaging: Single 10mg vacuum-sealed glass vial (3mL configuration) [1, 2, 3, 4, 5]
Reconstitution & Laboratory Storage
-
- Lyophilized Storage: To maintain optimal structural integrity and prevent natural peptide degradation, store the dry powder cake continuously frozen at or below -20°C prior to evaluation. Stable under properly desiccated conditions for up to 24 months from the manufacturing date. [1]
- Reconstitution Guidelines: Allow the glass vial to naturally acclimatize to room temperature before introducing an appropriate laboratory solvent, such as a sterile laboratory reagent. Gently swirl the container until the white powder dissolves completely. Do not shake or agitate aggressively, as high kinetic force can destabilize and fracture delicate peptide bonds. [1]
- Post-Reconstitution Storage: Once liquid solution has been introduced, store continuously refrigerated between 2°C and 8°C (36°F to 46°F). Protect entirely from prolonged exposure to direct light or ambient UV radiation. Utilize within 30 days of fluid integration.
Regulatory & Safety Disclosure
LABORATORY RESEARCH USE ONLY. This synthesized product is a purified chemical reagent intended exclusively for in vitro scientific research, biochemical analysis, and forensic evaluation. It is strictly NOT FOR HUMAN CONSUMPTION, therapeutic administration, clinical trials, or domestic diagnostic applications. This material must be handled exclusively by qualified, trained laboratory personnel utilizing appropriate personal protective equipment (PPE).
Reviews
There are no reviews yet.